Lineage for d1twnb_ (1twn B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098898Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1098899Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1098900Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
  6. 1098936Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 1098937Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries)
    Uniprot P09601
  8. 1098963Domain d1twnb_: 1twn B: [119367]
    automated match to d1ni6c_
    complexed with ver

Details for d1twnb_

PDB Entry: 1twn (more details), 2.2 Å

PDB Description: Crystal structures of ferrous and ferrous-NO forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1twnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twnb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1twnb_:

Click to download the PDB-style file with coordinates for d1twnb_.
(The format of our PDB-style files is described here.)

Timeline for d1twnb_: