Lineage for d1twnb1 (1twn B:10-223)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 648985Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 649019Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 649020Species Human (Homo sapiens) [TaxId:9606] [48616] (19 PDB entries)
  8. 649042Domain d1twnb1: 1twn B:10-223 [119367]
    automatically matched to d1ni6c_
    complexed with ver

Details for d1twnb1

PDB Entry: 1twn (more details), 2.2 Å

PDB Description: Crystal structures of ferrous and ferrous-NO forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage
PDB Compounds: (B:) Heme oxygenase 1

SCOP Domain Sequences for d1twnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twnb1 a.132.1.1 (B:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1twnb1:

Click to download the PDB-style file with coordinates for d1twnb1.
(The format of our PDB-style files is described here.)

Timeline for d1twnb1: