SCOP 1.73: Domain d1twna1: 1twn A:10-223

Lineage for d1twna1 (1twn A:10-223)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (19 PDB entries)

8. Domain d1twna1: 1twn A:10-223 [119366]
   automatically matched to d1ni6c_
   complexed with ver

Details for d1twna1

PDB Entry: 1twn, 2.2 Å

PDB Description: crystal structures of ferrous and ferrous-no forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage

PDB Compounds: (A:) Heme oxygenase 1

SCOP Domain Sequences for d1twna1:

Sequence; same for both SEQRES and ATOM records:

>d1twna1 a.132.1.1 (A:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1twna1:

• d1twna1 is new in SCOP 1.73
  
• d1twna1 appears in SCOP 1.75
  
• d1twna1 appears in the current release, SCOPe 2.08, called d1twna_