SCOPe 2.02: Domain d1tw0a1: 1tw0 A:1-147

Lineage for d1tw0a1 (1tw0 A:1-147)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Plant pathogenesis-related protein PR10 [75543] (2 species)

7. Species Jicama (Pachyrhizus erosus), SPE-16 [TaxId:109171] [143818] (1 PDB entry)
   Uniprot Q6T6J0 2-148

8. Domain d1tw0a1: 1tw0 A:1-147 [119364]
   Other proteins in same PDB: d1tw0b_

Details for d1tw0a1

PDB Entry: 1tw0, 2.2 Å

PDB Description: Native crystal structure of SPE16

PDB Compounds: (A:) pathogenesis-related class 10 protein SPE-16

SCOPe Domain Sequences for d1tw0a1:

Sequence; same for both SEQRES and ATOM records:

>d1tw0a1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaie

Timeline for d1tw0a1:

• d1tw0a1 first appeared in SCOP 1.73
  
• d1tw0a1 appears in SCOPe 2.01
  
• d1tw0a1 appears in SCOPe 2.03
  
• d1tw0a1 appears in the current release, SCOPe 2.08