Lineage for d1tuka1 (1tuk A:1-67)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770537Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 770538Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
    can be classified as disulfide-rich
  5. 770539Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (3 proteins)
  6. 770540Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (2 species)
    different pattern for Cys-pairing compared with ns-LTP1
  7. 770543Species Triticum turgidum [TaxId:4571] [89073] (2 PDB entries)
  8. 770544Domain d1tuka1: 1tuk A:1-67 [119342]
    automatically matched to d1n89a_
    complexed with iod, pgm

Details for d1tuka1

PDB Entry: 1tuk (more details), 1.12 Å

PDB Description: crystal structure of liganded type 2 non specific lipid transfer protein from wheat
PDB Compounds: (A:) Nonspecific lipid-transfer protein 2G

SCOP Domain Sequences for d1tuka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuka1 a.52.1.1 (A:1-67) Non-specific lipid-transfer protein homologue (ns-LTP2) {Triticum turgidum [TaxId: 4571]}
acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc
glavphc

SCOP Domain Coordinates for d1tuka1:

Click to download the PDB-style file with coordinates for d1tuka1.
(The format of our PDB-style files is described here.)

Timeline for d1tuka1: