SCOP 1.75: Domain d1tt1b1: 1tt1 B:3-117,B:120-253

Lineage for d1tt1b1 (1tt1 B:3-117,B:120-253)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (6 PDB entries)
   Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806

8. Domain d1tt1b1: 1tt1 B:3-117,B:120-253 [119339]
   automatically matched to 1S50 A:2-117,A:120-259
   complexed with kai

Details for d1tt1b1

PDB Entry: 1tt1, 1.93 Å

PDB Description: crystal structure of the glur6 ligand binding core in complex with kainate 1.93 a resolution

PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOP Domain Sequences for d1tt1b1:

Sequence; same for both SEQRES and ATOM records:

>d1tt1b1 c.94.1.1 (B:3-117,B:120-253) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkXpids
addlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlt
sdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeegk
lhmmkekwwr

Timeline for d1tt1b1:

• d1tt1b1 first appeared in SCOP 1.73
  
• d1tt1b1 does not appear in SCOPe 2.01