SCOPe 2.05: Domain d1tjpb_: 1tjp B:

Lineage for d1tjpb_ (1tjp B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189633] (13 PDB entries)

8. Domain d1tjpb_: 1tjp B: [119291]
   Other proteins in same PDB: d1tjpa_
   automated match to d2tysb_
   complexed with hpf, na, plp

Details for d1tjpb_

PDB Entry: 1tjp, 1.5 Å

PDB Description: Crystal Structure Of Wild-Type Tryptophan Synthase Complexed With 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1tjpb_:

Sequence; same for both SEQRES and ATOM records:

>d1tjpb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d1tjpb_:

• d1tjpb_ first appeared in SCOP 1.73, called d1tjpb1
  
• d1tjpb_ appears in SCOPe 2.04
  
• d1tjpb_ appears in SCOPe 2.06
  
• d1tjpb_ appears in the current release, SCOPe 2.08