SCOPe 2.01: Domain d1tjfb_: 1tjf B:

Lineage for d1tjfb_ (1tjf B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
   6 helices: bundle; left-handed twist, up-and-down topology

4. Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family)

5. Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)

6. Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (2 PDB entries)

8. Domain d1tjfb_: 1tjf B: [119289]
   automated match to d1s0pa_
   complexed with so4

Details for d1tjfb_

PDB Entry: 1tjf, 2.21 Å

PDB Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation

PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1tjfb_:

Sequence; same for both SEQRES and ATOM records:

>d1tjfb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
sgaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqs
kkpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgph
vaemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggd
aksatp

Timeline for d1tjfb_:

• d1tjfb_ first appeared in SCOP 1.73, called d1tjfb1
  
• d1tjfb_ was called d1tjfb1 in SCOP 1.75
  
• d1tjfb_ appears in SCOPe 2.02
  
• d1tjfb_ appears in the current release, SCOPe 2.08