SCOPe 2.03: Domain d1tj6b_: 1tj6 B:

Lineage for d1tj6b_ (1tj6 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (4 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [186773] (2 PDB entries)

8. Domain d1tj6b_: 1tj6 B: [119287]
   Other proteins in same PDB: d1tj6a1
   automated match to d1evha_

Details for d1tj6b_

PDB Entry: 1tj6, 1.65 Å

PDB Description: Crystal structure of the Xenopus tropicalis Spred1 EVH-1 domain

PDB Compounds: (B:) Spred1

SCOPe Domain Sequences for d1tj6b_:

Sequence, based on SEQRES records:

>d1tj6b_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvi
lecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Sequence, based on observed residues (ATOM records):

>d1tj6b_ b.55.1.0 (B:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dsyarvravvmtrddssggwlqlgggglssvtvsktleflvhgerlrdktvilecvlrrd
lvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg

Timeline for d1tj6b_:

• d1tj6b_ first appeared in SCOP 1.73, called d1tj6b1
  
• d1tj6b_ appears in SCOPe 2.02
  
• d1tj6b_ appears in SCOPe 2.04
  
• d1tj6b_ appears in the current release, SCOPe 2.08