Lineage for d1tfob1 (1tfo B:3-87)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765876Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) (S)
  5. 765877Family a.24.20.1: Colicin D immunity protein [101126] (1 protein)
  6. 765878Protein Colicin D immunity protein [101127] (1 species)
    tRNA-mimic
  7. 765879Species Escherichia coli [TaxId:562] [101128] (3 PDB entries)
  8. 765882Domain d1tfob1: 1tfo B:3-87 [119234]
    Other proteins in same PDB: d1tfoa1
    automatically matched to d1v74b_

Details for d1tfob1

PDB Entry: 1tfo (more details), 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
PDB Compounds: (B:) Colicin D immunity protein

SCOP Domain Sequences for d1tfob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfob1 a.24.20.1 (B:3-87) Colicin D immunity protein {Escherichia coli [TaxId: 562]}
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfkl

SCOP Domain Coordinates for d1tfob1:

Click to download the PDB-style file with coordinates for d1tfob1.
(The format of our PDB-style files is described here.)

Timeline for d1tfob1: