Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) automatically mapped to Pfam PF09204 |
Family a.24.20.1: Colicin D immunity protein [101126] (2 proteins) |
Protein automated matches [190050] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [186771] (2 PDB entries) |
Domain d1tfkb2: 1tfk B:3-87 [119232] Other proteins in same PDB: d1tfka_, d1tfkb3 automated match to d1v74b_ complexed with mes |
PDB Entry: 1tfk (more details), 2.1 Å
SCOPe Domain Sequences for d1tfkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfkb2 a.24.20.1 (B:3-87) automated matches {Escherichia coli [TaxId: 562]} kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda dranyeiddnglkvevrsilekfkl
Timeline for d1tfkb2: