Lineage for d1t98a2 (1t98 A:119-281)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642337Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 642391Superfamily a.47.6: MukF C-terminal domain-like [140570] (1 family) (S)
  5. 642392Family a.47.6.1: MukF C-terminal domain-like [140571] (1 protein)
    C-terminal part of Pfam PF03882
  6. 642393Protein Chromosome partition protein MukF (KicB), C-terminal domain [140572] (1 species)
  7. 642394Species Escherichia coli [TaxId:562] [140573] (1 PDB entry)
  8. 642395Domain d1t98a2: 1t98 A:119-281 [119197]
    Other proteins in same PDB: d1t98a1, d1t98b1

Details for d1t98a2

PDB Entry: 1t98 (more details), 2.9 Å

PDB Description: crystal structure of mukf(1-287)
PDB Compounds: (A:) Chromosome partition protein mukF

SCOP Domain Sequences for d1t98a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t98a2 a.47.6.1 (A:119-281) Chromosome partition protein MukF (KicB), C-terminal domain {Escherichia coli [TaxId: 562]}
efstlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlm
deqqqqvkddiaqllnkdwraaisscelllsetsgtlrelqdtleaagdklqanllriqd
atmthddlhfvdrlvfdlqskldriiswgqqsidlwigydrhv

SCOP Domain Coordinates for d1t98a2:

Click to download the PDB-style file with coordinates for d1t98a2.
(The format of our PDB-style files is described here.)

Timeline for d1t98a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t98a1