Lineage for d1t8ob_ (1t8o B:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962428Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1962618Protein automated matches [190046] (3 species)
    not a true protein
  7. 1962619Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)
  8. 1962637Domain d1t8ob_: 1t8o B: [119188]
    Other proteins in same PDB: d1t8oa_, d1t8oc_
    automated match to d1p2qb_
    complexed with so4; mutant

Details for d1t8ob_

PDB Entry: 1t8o (more details), 1.7 Å

PDB Description: crystal structure of the p1 trp bpti mutant- bovine chymotrypsin complex
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ob_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcwariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1t8ob_:

Click to download the PDB-style file with coordinates for d1t8ob_.
(The format of our PDB-style files is described here.)

Timeline for d1t8ob_: