Class g: Small proteins [56992] (94 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein automated matches [190046] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries) |
Domain d1t8mb_: 1t8m B: [119180] Other proteins in same PDB: d1t8ma_, d1t8mc_ automated match to d1bpi__ complexed with so4; mutant |
PDB Entry: 1t8m (more details), 1.8 Å
SCOPe Domain Sequences for d1t8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8mb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} rpdfcleppytgpchariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
Timeline for d1t8mb_: