SCOPe 2.04: Domain d1t8lb_: 1t8l B:

Lineage for d1t8lb_ (1t8l B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)

8. Domain d1t8lb_: 1t8l B: [119176]
   Other proteins in same PDB: d1t8la_, d1t8lc_
   automated match to d1p2ki_
   complexed with so4; mutant

Details for d1t8lb_

PDB Entry: 1t8l, 1.75 Å

PDB Description: crystal structure of the p1 met bpti mutant- bovine chymotrypsin complex

PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t8lb_:

Sequence; same for both SEQRES and ATOM records:

>d1t8lb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrpdfcleppytgpcmariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

Timeline for d1t8lb_:

• d1t8lb_ first appeared in SCOP 1.73, called d1t8lb1
  
• d1t8lb_ appears in SCOPe 2.03
  
• d1t8lb_ appears in SCOPe 2.05
  
• d1t8lb_ appears in the current release, SCOPe 2.08