Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins) Pfam PF00491 |
Protein Arginase [52770] (5 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries) |
Domain d1t5fb1: 1t5f B:6-319 [119155] automatically matched to 1T5F A:6-319 complexed with dhh, mn |
PDB Entry: 1t5f (more details), 2.2 Å
SCOP Domain Sequences for d1t5fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5fb1 c.42.1.1 (B:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]} kpieiigapfskgcprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlaviwvda htdintplttssgnlagqpvafllkelkgkfpdvpgfswvtpaisakdivyiglrdvdpg ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlsafg tkregnhkpetdyl
Timeline for d1t5fb1: