SCOP 1.73: Domain d1t5fb1: 1t5f B:6-319

Lineage for d1t5fb1 (1t5f B:6-319)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)

8. Domain d1t5fb1: 1t5f B:6-319 [119155]
   automatically matched to 1T5F A:6-319
   complexed with dhh, mn

Details for d1t5fb1

PDB Entry: 1t5f, 2.2 Å

PDB Description: arginase i-aoh complex

PDB Compounds: (B:) arginase 1

SCOP Domain Sequences for d1t5fb1:

Sequence; same for both SEQRES and ATOM records:

>d1t5fb1 c.42.1.1 (B:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgcprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlaviwvda
htdintplttssgnlagqpvafllkelkgkfpdvpgfswvtpaisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlsafg
tkregnhkpetdyl

Timeline for d1t5fb1:

• d1t5fb1 is new in SCOP 1.73
  
• d1t5fb1 appears in SCOP 1.75
  
• d1t5fb1 appears in the current release, SCOPe 2.08, called d1t5fb_