SCOPe 2.01: Domain d1t4fm_: 1t4f M:

Lineage for d1t4fm_ (1t4f M:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (14 PDB entries)

8. Domain d1t4fm_: 1t4f M: [119144]
   automated match to d1rv1a_
   complexed with so4

Details for d1t4fm_

PDB Entry: 1t4f, 1.9 Å

PDB Description: Structure of human MDM2 in complex with an optimized p53 peptide

PDB Compounds: (M:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1t4fm_:

Sequence; same for both SEQRES and ATOM records:

>d1t4fm_ a.42.1.1 (M:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
gdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d1t4fm_:

• d1t4fm_ first appeared in SCOP 1.73, called d1t4fm1
  
• d1t4fm_ was called d1t4fm1 in SCOP 1.75
  
• d1t4fm_ appears in SCOPe 2.02
  
• d1t4fm_ appears in the current release, SCOPe 2.08