Lineage for d1t32a1 (1t32 A:16-244)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802379Protein Cathepsin G [50548] (1 species)
  7. 802380Species Human (Homo sapiens) [TaxId:9606] [50549] (4 PDB entries)
  8. 802381Domain d1t32a1: 1t32 A:16-244 [119136]
    automatically matched to d1kynb_
    complexed with ohh, so4

Details for d1t32a1

PDB Entry: 1t32 (more details), 1.85 Å

PDB Description: A Dual Inhibitor of the Leukocyte Proteases Cathepsin G and Chymase with Therapeutic Efficacy in Animals Models of Inflammation
PDB Compounds: (A:) cathepsin G

SCOP Domain Sequences for d1t32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

SCOP Domain Coordinates for d1t32a1:

Click to download the PDB-style file with coordinates for d1t32a1.
(The format of our PDB-style files is described here.)

Timeline for d1t32a1: