Lineage for d1t1fc_ (1t1f C:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054198Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 1054199Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 1054200Family e.1.1.1: Serpins [56575] (17 proteins)
  6. 1054211Protein Antithrombin [56584] (2 species)
  7. 1054215Species Human (Homo sapiens) [TaxId:9606] [56586] (26 PDB entries)
    Uniprot P01008
  8. 1054239Domain d1t1fc_: 1t1f C: [119109]
    automated match to d2anti_
    complexed with gol, iod

Details for d1t1fc_

PDB Entry: 1t1f (more details), 2.75 Å

PDB Description: crystal structure of native antithrombin in its monomeric form
PDB Compounds: (C:) antithrombin-III

SCOPe Domain Sequences for d1t1fc_:

Sequence, based on SEQRES records: (download)

>d1t1fc_ e.1.1.1 (C:) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
gspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfatt
fyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihf
ffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeq
sraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfyk
adgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltp
evlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrdd
lyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntii
fmgrvanpcvk

Sequence, based on observed residues (ATOM records): (download)

>d1t1fc_ e.1.1.1 (C:) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
gspvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndn
dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
evneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcvk

SCOPe Domain Coordinates for d1t1fc_:

Click to download the PDB-style file with coordinates for d1t1fc_.
(The format of our PDB-style files is described here.)

Timeline for d1t1fc_: