Lineage for d1t1fb_ (1t1f B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949015Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 1949016Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 1949017Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 1949028Protein Antithrombin [56584] (2 species)
  7. 1949032Species Human (Homo sapiens) [TaxId:9606] [56586] (27 PDB entries)
    Uniprot P01008
  8. 1949057Domain d1t1fb_: 1t1f B: [119108]
    automated match to d2anti_
    complexed with gol, iod

Details for d1t1fb_

PDB Entry: 1t1f (more details), 2.75 Å

PDB Description: crystal structure of native antithrombin in its monomeric form
PDB Compounds: (B:) antithrombin-III

SCOPe Domain Sequences for d1t1fb_:

Sequence, based on SEQRES records: (download)

>d1t1fb_ e.1.1.1 (B:) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
gspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfatt
fyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihf
ffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeq
sraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfyk
adgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltp
evlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrdd
lyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntii
fmgrvanpcvk

Sequence, based on observed residues (ATOM records): (download)

>d1t1fb_ e.1.1.1 (B:) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
gspvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndn
dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
evneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcvk

SCOPe Domain Coordinates for d1t1fb_:

Click to download the PDB-style file with coordinates for d1t1fb_.
(The format of our PDB-style files is described here.)

Timeline for d1t1fb_: