Lineage for d1svdm1 (1svd M:3-110)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865118Species Halothiobacillus neapolitanus [TaxId:927] [143512] (1 PDB entry)
    Uniprot P45686 3-110
  8. 865119Domain d1svdm1: 1svd M:3-110 [119059]
    Other proteins in same PDB: d1svda1, d1svda2
    complexed with gol, so4

Details for d1svdm1

PDB Entry: 1svd (more details), 1.8 Å

PDB Description: The structure of Halothiobacillus neapolitanus RuBisCo
PDB Compounds: (M:) ribulose bisphosphate carboxylase small chain

SCOP Domain Sequences for d1svdm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svdm1 d.73.1.1 (M:3-110) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Halothiobacillus neapolitanus [TaxId: 927]}
emqdykqslkyetfsylppmnaeriraqikyaiaqgwspgiehvevknsmnqywymwklp
ffgeqnvdnvlaeieacrsaypthqvklvaydnyaqslglafvvyrgn

SCOP Domain Coordinates for d1svdm1:

Click to download the PDB-style file with coordinates for d1svdm1.
(The format of our PDB-style files is described here.)

Timeline for d1svdm1: