Lineage for d1svda2 (1svd A:16-142)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652842Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1652843Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1652844Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1652905Species Halothiobacillus neapolitanus [TaxId:927] [143362] (1 PDB entry)
    Uniprot O85040 16-142
  8. 1652906Domain d1svda2: 1svd A:16-142 [119058]
    Other proteins in same PDB: d1svda1, d1svdm1
    complexed with gol, so4

Details for d1svda2

PDB Entry: 1svd (more details), 1.8 Å

PDB Description: The structure of Halothiobacillus neapolitanus RuBisCo
PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit

SCOPe Domain Sequences for d1svda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svda2 d.58.9.1 (A:16-142) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Halothiobacillus neapolitanus [TaxId: 927]}
tywmpeytpldsdilacfkitpqpgvdreeaaaavaaesstgtwttvwtdlltdmdyykg
rayriedvpgddaafyafiaypidlfeegsvvnvftslvgnvfgfkavrglrledvrfpl
ayvktcg

SCOPe Domain Coordinates for d1svda2:

Click to download the PDB-style file with coordinates for d1svda2.
(The format of our PDB-style files is described here.)

Timeline for d1svda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1svdm1