| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
| Family c.66.1.1: COMT-like [53336] (3 proteins) |
| Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries) |
| Domain d1susc1: 1sus C:21-247 [119055] automatically matched to 1SUI A:21-247 complexed with ca, sah, spf |
PDB Entry: 1sus (more details), 2.7 Å
SCOP Domain Sequences for d1susc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1susc1 c.66.1.1 (C:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik
Timeline for d1susc1: