| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
| Family c.66.1.1: COMT-like [53336] (4 proteins) |
| Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries) Uniprot Q40313 21-247 |
| Domain d1susa_: 1sus A: [119053] automated match to d1suia1 complexed with ca, sah, spf |
PDB Entry: 1sus (more details), 2.7 Å
SCOPe Domain Sequences for d1susa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1susa_ c.66.1.1 (A:) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik
Timeline for d1susa_: