Lineage for d1suia1 (1sui A:21-247)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704541Family c.66.1.1: COMT-like [53336] (3 proteins)
  6. 704542Protein Caffeoyl-CoA O-methyltransferase [142573] (1 species)
  7. 704543Species Alfalfa (Medicago sativa) [TaxId:3879] [142574] (2 PDB entries)
  8. 704544Domain d1suia1: 1sui A:21-247 [119049]
    complexed with ca, fre, sah

Details for d1suia1

PDB Entry: 1sui (more details), 2.7 Å

PDB Description: alfalfa caffeoyl coenzyme a 3-o-methyltransferase
PDB Compounds: (A:) Caffeoyl-CoA O-methyltransferase

SCOP Domain Sequences for d1suia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suia1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik

SCOP Domain Coordinates for d1suia1:

Click to download the PDB-style file with coordinates for d1suia1.
(The format of our PDB-style files is described here.)

Timeline for d1suia1: