Lineage for d1sqxj1 (1sqx J:2-61)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887564Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 887565Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 887566Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 887582Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
    Uniprot P00130
  8. 887592Domain d1sqxj1: 1sqx J:2-61 [119047]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxi1, d1sqxk1
    automatically matched to d1be3j_
    complexed with fes, hem, sma, uq2

Details for d1sqxj1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOP Domain Sequences for d1sqxj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxj1 f.23.14.1 (J:2-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

SCOP Domain Coordinates for d1sqxj1:

Click to download the PDB-style file with coordinates for d1sqxj1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxj1: