Lineage for d1sqxi1 (1sqx I:1-57)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879358Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 879359Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 879374Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 879375Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 879376Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    Uniprot P13272 1-57
    Uniprot P13272
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 879385Domain d1sqxi1: 1sqx I:1-57 [119046]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxg1, d1sqxh1, d1sqxj1, d1sqxk1
    automatically matched to d1l0li_
    complexed with fes, hem, sma, uq2

Details for d1sqxi1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (I:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1sqxi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOP Domain Coordinates for d1sqxi1:

Click to download the PDB-style file with coordinates for d1sqxi1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxi1: