Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein automated matches [190042] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186764] (5 PDB entries) |
Domain d1sqxh_: 1sqx H: [119045] Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxf1, d1sqxg_, d1sqxi1, d1sqxj_, d1sqxk_ automated match to d1l0lh_ complexed with fes, hem, sma, uq2 |
PDB Entry: 1sqx (more details), 2.6 Å
SCOPe Domain Sequences for d1sqxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqxh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah klfnslk
Timeline for d1sqxh_: