SCOPe 2.03: Domain d1sqxd1: 1sqx D:1-195

Lineage for d1sqxd1 (1sqx D:1-195)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
   Uniprot P00125

8. Domain d1sqxd1: 1sqx D:1-195 [119041]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
   automated match to d1ppjd1
   complexed with fes, hem, sma, uq2

Details for d1sqxd1

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (D:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqxd1:

Sequence; same for both SEQRES and ATOM records:

>d1sqxd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1sqxd1:

• d1sqxd1 first appeared in SCOP 1.73
  
• d1sqxd1 appears in SCOPe 2.02
  
• d1sqxd1 appears in SCOPe 2.04
  
• d1sqxd1 appears in the current release, SCOPe 2.08