Lineage for d1sqxc1 (1sqx C:261-379)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580258Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2580259Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2580260Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2580261Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 2580283Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
    Uniprot P00157
  8. 2580294Domain d1sqxc1: 1sqx C:261-379 [119039]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1ntmc1
    complexed with fes, hem, sma, uq2

Details for d1sqxc1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqxc1:

Click to download the PDB-style file with coordinates for d1sqxc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxc1: