Lineage for d1sqvj1 (1sqv J:1-61)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745953Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 745954Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 745955Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 745967Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
  8. 745981Domain d1sqvj1: 1sqv J:1-61 [119032]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf1, d1sqvg1, d1sqvh1, d1sqvi1
    automatically matched to d1be3j_
    complexed with fes, hem, uhd, uq2

Details for d1sqvj1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOP Domain Sequences for d1sqvj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvj1 f.23.14.1 (J:1-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

SCOP Domain Coordinates for d1sqvj1:

Click to download the PDB-style file with coordinates for d1sqvj1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvj1: