Lineage for d1sqvi1 (1sqv I:1-57)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739154Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 739155Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 739170Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 739171Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 739172Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
  8. 739185Domain d1sqvi1: 1sqv I:1-57 [119031]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf1, d1sqvg1, d1sqvh1, d1sqvj1
    automatically matched to d1l0li_
    complexed with fes, hem, uhd, uq2

Details for d1sqvi1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with UHDBT
PDB Compounds: (I:) Ubiquinol-cytochrome C reductase complex 8 kDa protein

SCOP Domain Sequences for d1sqvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOP Domain Coordinates for d1sqvi1:

Click to download the PDB-style file with coordinates for d1sqvi1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvi1: