Lineage for d1sqvh_ (1sqv H:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239331Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1239332Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 1239333Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1239367Protein automated matches [190042] (2 species)
    not a true protein
  7. 1239377Species Cow (Bos taurus) [TaxId:9913] [186764] (5 PDB entries)
  8. 1239382Domain d1sqvh_: 1sqv H: [119030]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf_, d1sqvg_, d1sqvi1, d1sqvj_, d1sqvk_
    automated match to d1l0lh_
    complexed with fes, hem, uhd, uq2

Details for d1sqvh_

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d1sqvh_:

Click to download the PDB-style file with coordinates for d1sqvh_.
(The format of our PDB-style files is described here.)

Timeline for d1sqvh_: