Lineage for d1sqvg1 (1sqv G:1-75)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745916Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 745917Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 745918Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 745930Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
  8. 745945Domain d1sqvg1: 1sqv G:1-75 [119029]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf1, d1sqvh1, d1sqvi1, d1sqvj1
    automatically matched to d1be3g_
    complexed with fes, hem, uhd, uq2

Details for d1sqvg1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1sqvg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvg1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1sqvg1:

Click to download the PDB-style file with coordinates for d1sqvg1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvg1: