| Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
| Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
| Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
| Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) |
| Domain d1sqvg1: 1sqv G:1-75 [119029] Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf1, d1sqvh1, d1sqvi1, d1sqvj1 automatically matched to d1be3g_ complexed with fes, hem, uhd, uq2 |
PDB Entry: 1sqv (more details), 2.85 Å
SCOP Domain Sequences for d1sqvg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqvg1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa
Timeline for d1sqvg1: