Lineage for d1sqvf_ (1sqv F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699236Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699237Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1699238Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1699268Protein automated matches [190325] (4 species)
    not a true protein
  7. 1699294Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)
  8. 1699299Domain d1sqvf_: 1sqv F: [119028]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_
    automated match to d1qcrf_
    complexed with fes, hem, uhd, uq2

Details for d1sqvf_

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1sqvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1sqvf_:

Click to download the PDB-style file with coordinates for d1sqvf_.
(The format of our PDB-style files is described here.)

Timeline for d1sqvf_: