SCOPe 2.03: Domain d1sqvf_: 1sqv F:

Lineage for d1sqvf_ (1sqv F:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)

8. Domain d1sqvf_: 1sqv F: [119028]
   Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_
   automated match to d1qcrf_
   complexed with fes, hem, uhd, uq2

Details for d1sqvf_

PDB Entry: 1sqv, 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1sqvf_:

Sequence; same for both SEQRES and ATOM records:

>d1sqvf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1sqvf_:

• d1sqvf_ first appeared in SCOP 1.73, called d1sqvf1
  
• d1sqvf_ appears in SCOPe 2.02
  
• d1sqvf_ appears in SCOPe 2.04
  
• d1sqvf_ appears in the current release, SCOPe 2.08