SCOP 1.73: Domain d1sqvd2: 1sqv D:196-241

Lineage for d1sqvd2 (1sqv D:196-241)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)

8. Domain d1sqvd2: 1sqv D:196-241 [119027]
   Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvf1, d1sqvg1, d1sqvh1, d1sqvi1, d1sqvj1
   automatically matched to d1be3d3
   complexed with fes, hem, uhd, uq2

Details for d1sqvd2

PDB Entry: 1sqv, 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOP Domain Sequences for d1sqvd2:

Sequence; same for both SEQRES and ATOM records:

>d1sqvd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1sqvd2:

• d1sqvd2 is new in SCOP 1.73
  
• d1sqvd2 appears in SCOP 1.75
  
• d1sqvd2 appears in the current release, SCOPe 2.08