![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) |
![]() | Protein Cytochrome bc1 domain [46677] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries) Uniprot P00125 |
![]() | Domain d1sqvd1: 1sqv D:1-195 [119026] Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd2, d1sqvf1, d1sqvg1, d1sqvh1, d1sqvi1, d1sqvj1, d1sqvk1 automatically matched to d1be3d2 complexed with fes, hem, uhd, uq2 |
PDB Entry: 1sqv (more details), 2.85 Å
SCOP Domain Sequences for d1sqvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqvd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1sqvd1: