Lineage for d1sqvc1 (1sqv C:261-379)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239405Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1239406Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1239407Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1239408Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1239426Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
    Uniprot P00157
  8. 1239439Domain d1sqvc1: 1sqv C:261-379 [119024]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi1, d1sqvj_, d1sqvk_
    automatically matched to d1be3c2
    complexed with fes, hem, uhd, uq2

Details for d1sqvc1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with UHDBT
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqvc1:

Click to download the PDB-style file with coordinates for d1sqvc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvc1: