Lineage for d1sqvb1 (1sqv B:18-235)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879393Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 879394Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 879395Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 879470Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 879492Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)
  8. 879501Domain d1sqvb1: 1sqv B:18-235 [119022]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqvf1, d1sqvg1, d1sqvh1, d1sqvi1, d1sqvj1, d1sqvk1
    automatically matched to d1bccb1
    complexed with fes, hem, uhd, uq2

Details for d1sqvb1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOP Domain Sequences for d1sqvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqvb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt
kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev
aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn
hftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1sqvb1:

Click to download the PDB-style file with coordinates for d1sqvb1.
(The format of our PDB-style files is described here.)

Timeline for d1sqvb1: