| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) ![]() not a true superfamily |
| Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein) beta-hairpin and a short alpha-helix bound to the core subunits |
| Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries) Uniprot P13272 1-57 Uniprot P13272 there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop Uniprot P13272 1-57 ! Uniprot P13272 |
| Domain d1sqqi1: 1sqq I:1-57 [119018] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqj1, d1sqqk1 automatically matched to d1l0li_ complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOP Domain Sequences for d1sqqi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
Timeline for d1sqqi1: