Lineage for d1sqqi1 (1sqq I:1-57)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879358Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 879359Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 879374Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 879375Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 879376Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
    Uniprot P13272 1-57
    Uniprot P13272
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 879391Domain d1sqqi1: 1sqq I:1-57 [119018]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqj1, d1sqqk1
    automatically matched to d1l0li_
    complexed with fes, hem, ost, uq2

Details for d1sqqi1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOP Domain Sequences for d1sqqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOP Domain Coordinates for d1sqqi1:

Click to download the PDB-style file with coordinates for d1sqqi1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqi1: