Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein automated matches [190042] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186764] (6 PDB entries) |
Domain d1sqqh_: 1sqq H: [119017] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d1l0lh_ complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc vahklfnslk
Timeline for d1sqqh_: