Lineage for d1sqqh_ (1sqq H:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255712Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2255713Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2255714Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2255745Protein automated matches [190042] (3 species)
    not a true protein
  7. 2255763Species Cow (Bos taurus) [TaxId:9913] [186764] (6 PDB entries)
  8. 2255769Domain d1sqqh_: 1sqq H: [119017]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d1l0lh_
    complexed with fes, hem, ost, uq2

Details for d1sqqh_

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
vahklfnslk

SCOPe Domain Coordinates for d1sqqh_:

Click to download the PDB-style file with coordinates for d1sqqh_.
(The format of our PDB-style files is described here.)

Timeline for d1sqqh_: