SCOPe 2.03: Domain d1sqqh1: 1sqq H:12-78

Lineage for d1sqqh1 (1sqq H:12-78)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (13 PDB entries)
   Uniprot P00126

8. Domain d1sqqh1: 1sqq H:12-78 [119017]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqi1, d1sqqj1, d1sqqk1
   automatically matched to d1l0lh_
   complexed with fes, hem, ost, uq2

Details for d1sqqh1

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqqh1:

Sequence; same for both SEQRES and ATOM records:

>d1sqqh1 f.28.1.1 (H:12-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

Timeline for d1sqqh1:

• d1sqqh1 first appeared in SCOP 1.73
  
• d1sqqh1 appears in SCOPe 2.02
  
• d1sqqh1 is called d1sqqh_ in SCOPe 2.04
  
• d1sqqh1 appears in the current release, SCOPe 2.08, called d1sqqh_