Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries) Uniprot P00129 |
Domain d1sqqf1: 1sqq F:6-110 [119015] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automatically matched to d1l0lf_ complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d1sqqf1: