SCOP 1.73: Domain d1sqqf1: 1sqq F:6-110

Lineage for d1sqqf1 (1sqq F:6-110)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (17 PDB entries)

8. Domain d1sqqf1: 1sqq F:6-110 [119015]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1
   automatically matched to d1l0lf_
   complexed with fes, hem, ost, uq2

Details for d1sqqf1

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d1sqqf1:

Sequence; same for both SEQRES and ATOM records:

>d1sqqf1 f.27.1.1 (F:6-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1sqqf1:

• d1sqqf1 is new in SCOP 1.73
  
• d1sqqf1 appears in SCOP 1.75
  
• d1sqqf1 appears in the current release, SCOPe 2.08