![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) ![]() |
![]() | Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
![]() | Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries) |
![]() | Domain d1sqqd2: 1sqq D:196-241 [119014] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1 automatically matched to d1be3d3 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOP Domain Sequences for d1sqqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]} pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d1sqqd2: