Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein automated matches [232767] (3 species) not a true protein |
Domain d1sqqd1: 1sqq D:1-195 [119013] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d2a06d1 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqd1 a.3.1.3 (D:1-195) automated matches {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1sqqd1: