Lineage for d1sqqd1 (1sqq D:1-195)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 634162Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 634163Protein Cytochrome bc1 domain [46677] (3 species)
  7. 634175Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
  8. 634192Domain d1sqqd1: 1sqq D:1-195 [119013]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1
    automatically matched to d1be3d2
    complexed with fes, hem, ost, uq2

Details for d1sqqd1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Methoxy Acrylate Stilbene (MOAS)
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOP Domain Sequences for d1sqqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1sqqd1:

Click to download the PDB-style file with coordinates for d1sqqd1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqd1: