Lineage for d1sqqc2 (1sqq C:2-260)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887002Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 887003Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 887009Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 887021Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 887039Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries)
    Uniprot P00157
  8. 887054Domain d1sqqc2: 1sqq C:2-260 [119012]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1
    automatically matched to d1be3c3
    complexed with fes, hem, ost, uq2

Details for d1sqqc2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d1sqqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqc2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

SCOP Domain Coordinates for d1sqqc2:

Click to download the PDB-style file with coordinates for d1sqqc2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqc2: