Lineage for d1sqqc1 (1sqq C:261-379)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060751Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1060752Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1060753Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1060754Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1060772Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
    Uniprot P00157
  8. 1060787Domain d1sqqc1: 1sqq C:261-379 [119011]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1
    automatically matched to d1be3c2
    complexed with fes, hem, ost, uq2

Details for d1sqqc1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqqc1:

Click to download the PDB-style file with coordinates for d1sqqc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqc1: